SKU: 98067114307

Human Fas/CD95, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Fas/CD95, His tagProduct Specification Species Human Synonyms Apo 1 antigen, Apoptosis mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6 Accession P25445 Amino Acid Sequence Protein sequence (P25445, Met1 Asn173, with C 10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6
Accession P25445
Amino Acid Sequence

Protein sequence (P25445, Met1-Asn173, with C-10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-40 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98067114307

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 2413 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nicolás
Chelsea, US
★★★★★ 5
Perfect for a low-maintenance man
Size: 1.7 Fl Oz (Pack of 1)
I have very fair skin and am a low maintenance kind of guy. My entire skin care routine is washing my face and trying my best to remember to put on sunscreen. This is the best face sunscreen I have ever used. It literally seems to disappear on my face immediately after applying it. I sometimes doubt I even got it spread evenly because of how quickly it disappears but it has worked just as well as thicker sunscreens I have used in the past. I would bet this would be great for women under their makeup because it wouldn't feel like another layer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
J
Verified Purchase
Jhenna S.
Dallas, US
★★★★★ 4
~ Oily Skin Review ~ (Updated)
Size: 1.7 Fl Oz (Pack of 1)
I haven’t seen any oily skin reviews of this product so I took a shot of buying it and trying for myself. Hopefully this review helps you. I have oily combo skin. It is also sensitive and prone to breaking out. When I shook the product, as instructed, it was not a gel I was expecting. It’s kind of matte gel (almost like a primer), which I don’t like using matte products since it makes me even more oily and the texture of the gel is like a primer. Kind of greasy but soft. However, when rubbed into the skin all the way it surprisingly left my face feeling soft and not really greasy, and even though it’s suppose to be a matte finish, I think because I used my cerave moisturizer first, it left more of a satin finish. After a couple hours I was happy to see that my face wasn’t ridiculously shining! It had a nice glow, and my face (mainly in the T-zone) felt a little bit slippery which I’ll call a win because like I said earlier the product had a bit of a greasy texture so I was expecting to feel REALLY greasy but I didn’t. And another huge bonus is it did not cause me to break out!! Usually my skin with purge on day one of using something new and my skin did not! If you have oily skin I would say try it IF you want to. The price is a bit too much in my opinion, I’d rather spend maybe $15 max on this product but honestly the results, for me, I think I would purchase it again. But oily skin responds differently for everyone so if you wanna try it, I’d say got for it. But if you don’t wanna risk it because of the price, honestly wouldn’t blame you for not trying it. Update: So I have used this for I don’t know how long now. Imma say this much. For colder seasons, my skin loves it. For warmed seasons my face starts to feel extra greasy. Bought the Daily Face liquid, my skin loves it! Have not broken out from it, no white cast. Would recommend not using the gel during warmer seasons.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2024
K
Verified Purchase
Katy L
Alexandria, US
★★★★★ 5
Lightweight and sheer sunscreen
Size: 1.7 Fl Oz (Pack of 1), Size: 1.7 Fl Oz (Pack of 1)
This is very lightweight and sheer. It’s blends into the skin nicely. I use under my makeup daily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
J
Verified Purchase
Janelle Tapia
West Palm Beach, US
★★★★★ 5
Reliable
Size: 1.7 Fl Oz (Pack of 1)
I was kinda surprised by the texture, I'd call it a dupe for super goop! Its got that sort of light balmy ish, matte, velvety type of primer feel to it. It actually works well on top of makeup or under it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
E
Verified Purchase
Elena
Pawtucket, US
★★★★★ 5
Great sunscreen fir sensitive skin.
Size: 1.7 Fl Oz (Pack of 1), Size: 1.7 Fl Oz (Pack of 1)
Oh boy. What a gem to find for super sensitive face skin. Clear, no irritation. Will be buying more. I thought it would be bigger the size because im going to Asia for 3 months. Nope small. Guess illnhave to buy 2 more of this amazing sunscreen. No white residue, no irritation. Goes on smooth and absorbs very quickly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026

recommand products