Human PAPP-A, His Tag
SKU: 29978959269

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29978959269

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 946 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tracey PK
New York, US
★★★★★ 4
Comfy
Size: 7.5, Color: Green
Another review said they look like orthopedic shoes and I agree. But they are very comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
L
Verified Purchase
LovinShopping
Draper, US
★★★★★ 5
Comfortable and cute
Size: 9, Color: Beige
Nice sandals
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
D
Verified Purchase
DENISE POWERS
Houston, US
★★★★★ 5
Love them
Size: 11, Color: Brown
Runs a little large but great quality and feels great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
K
Verified Purchase
Kristi Perez
Charlottesville, US
★★★★★ 5
Stylish and comfy
Size: 7.5, Color: Brown
Super cute and comfy sandals! I love that they are adjustable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
T
Verified Purchase
Tai
Port Orchard, US
★★★★★ 5
Coach Quality Never Fails
Size: One Size, Color: Black 1, Size: One Size, Color: Black 1
I'm not sure why there are any reviews complaining of silver hardware or size as that information is clearly listed in the product descriptions. One also needs to order directly from Coach and select the gift option to get the gift box and dust bag, which has always been the case. This Tabby is the perfect size to hold the contents of your wallet, your phone, and your keys. It's a clutch bag. The bag I received has silver hardware and full grain leather as advertised. It's a beautiful, quality bag and the difference between this and a fake is clear; the material feels durable and soft at the same time. The bag smells like leather. Ultimately, as I read and did my research, I'm very pleased with my purchase. I've dressed it up with a cheaper, smaller strap as I'm using this as an oversized wristlet at the moment; but I got everything I paid for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026

recommand products